Alternative Name(s):

D-serine transporter Solute carrier family 7 member 10

Species: (Organism)

Mus musculus (Mouse)

Gene Names:

Slc7a10

Tag info:

N-terminal 6xHis-sumostar-tagged

Target Protein AA Sequence:

WRSKPKCVHRFTESMTRWGQELCFVVYPQGSLEEEENGPMGQPSPLPITDKPLKTQ

Expression Region:

475-530aa

Subcellular Location:

Membrane, Multi-pass membrane protein

Tissue Specificity:

Highly expressed in brain and lung, and to a lesser extent in placenta and small intestine.

Protein Length:

Partial

Pathway:

Mol. Weight:

22.5 kDa

Purity:

Greater than 90% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Others

Function:

Sodium-independent, high affinity transport of small neutral D- and L-amino acids and amino acid-related compounds. May play a role in the modulation of glutamatergic transmission through mobilization of D-serine at the glutamatergic synapse.

Involvement in disease:

Relevance:

Sodium-independent, high affinity transport of small neutral D- and L-amino acids and amino acid-related compounds. May play a role in the modulation of glutamatergic transmission through mobilization of D-serine at the glutamatergic synapse.

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

Amino acid-polyamine-organocation (APC) superfamily

Reference:

"Identification and characterization of a Na+-independent neutral amino acid transporter that associates with the 4F2 heavy chain and exhibits substrate selectivity for small neutral D- and L- amino acids." Fukasawa Y., Segawa H., Kim J.Y., Chairoungdua A., Kim D.K., Matsuo H., Cha S.H., Endou H., Kanai Y. J. Biol. Chem. 275:9690-9698(2000)