Recombinant Lymphocytic choriomeningitis virus Pre-glycoprotein polyprotein GP complex(GPC),partial CSB-BP362127LKZ1
Specifications
| 20ug / 100ug / 500ug price = 100ug |
Alternative Name(s):
GP-C
Species: (Organism)
Lymphocytic choriomeningitis virus (strain WE) (LCMV)
Gene Names:
GPC
Tag info:
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Target Protein AA Sequence:
MYGLNGPDIYKGVYQFKSVEFDMSHLNLTMPNACSVNNSHHYISMGSSGLEPTFTNDSILNHNFCNLTSALNKKSFDHTLMSIVSSLHLSIRGNSNYKAVSCDFNNGITIQYNLSSSDPQSAMSQCRTFRGRVLDMFRTAFGGKYMRSGWGWTGSDGKTTWCSQTSYQYLIIQNRTWENHCRYAGPFGMSRILFAQEKTKFLTRRLS
Expression Region:
59-265aa
Subcellular Location:
Stable signal peptide: Virion membrane, Multi-pass membrane protein, Host endoplasmic reticulum membrane, Multi-pass membrane protein, Host Golgi apparatus membrane, Multi-pass membrane protein, Host cell membrane, Multi-pass membrane protein, SUBCELLULAR LOCATION: Glycoprotein G1: Virion membrane, Peripheral membrane protein, Host endoplasmic reticulum membrane, Peripheral membrane protein, Host Golgi apparatus membrane, Peripheral membrane protein, Host cell membrane, Peripheral membrane protein, SUBCELLULAR LOCATION: Glycoprotein G2: Virion membrane, Single-pass membrane protein, Host endoplasmic reticulum membrane, Single-pass membrane protein, Host Golgi apparatus membrane, Single-pass membrane protein, Host cell membrane, Single-pass membrane protein
Tissue Specificity:
Protein Length:
Partial
Pathway:
Mol. Weight:
27.4 kDa
Purity:
Greater than 85% as determined by SDS-PAGE.
Form:
Liquid or Lyophilized powder
Buffer:
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Research Areas:
Signal Transduction
Function:
The stable signal peptide (SSP) is cleaved and functions as a signal peptide. In addition, it is apparently retained as the third component of the GP complex. The SSP is required for efficient glycoprotein expression, post-translational maturation cleavage of GP1 and GP2, glycoprotein transport to the cell surface plasma membrane, formation of infectious virus particles, and acid pH-dependent glycoprotein-mediated cell fusion (By similarity).
Involvement in disease:
Relevance:
Glycoprotein G2: class I viral fusion protein that directs fusion of viral and host endosomal membranes, leading to delivery of the nucleocapsid into the cytoplasm. Membrane fusion is mediated by irreversible conformational changes induced upon acidification in the endosome.Stable signal peptide: cleaved and functions as a signal peptide. In addition, it is also retained as the third component of the GP complex. The SSP is required for efficient glycoprotein expression, post-translational maturation cleavage of GP1 and GP2, glycoprotein transport to the cell surface plasma membrane, formation of infectious virus particles, and acid pH-dependent glycoprotein-mediated cell fusion.Glycoprotein G1: interacts with the host receptor.
Reconstitution:
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Protein Families:
Arenaviridae GPC protein family
Reference:
"Unexpected T-cell recognition of an altered peptide ligand is driven by reversed thermodynamics." Allerbring E.B., Duru A.D., Uchtenhagen H., Madhurantakam C., Tomek M.B., Grimm S., Mazumdar P.A., Friemann R., Uhlin M., Sandalova T., Nygren P.A., Achour A. Eur. J. Immunol. 42:2990-3000(2012)
