Source:

CHO

Molecular Weight:

8 kDa, observed by reducing SDS-PAGE.

Purity:

> 98% as analyzed by SDS-PAGE.

Biological activity:

The EC50 value of humanMIP-3 alpha/CCL20 on Caˆ2+ mobilization assay in CHO-K1/Ga15/hCCR6 cells (human Ga15 and human CCR6 stably expressed in CHO-K1 cells) is less than 200 ng/ml.

AA Sequence:

ASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCANPKQTWVKYIV RLLSKKVKNM

Endotoxin:

< 0.2 EU/μg, determined by LAL method.

Formulation:

Lyophilized after extensive dialysis against PBS.

Background:

Chemokine (C-C motif) ligand 20 (CCL20) also known as liver activation regulated chemokine (LARC) or Macrophage Inflammatory Protein-3 (MIP3 alpha) is a small cytokine belonging to the CC chemokine family. It is strongly chemotactic for lymphocytes and weakly attracts neutrophils. Additionally, it promotes the adhesion of memory CD4+ T cells and inhibits colony formation of bone marrow myeloid immature progenitors.Recombinant humanMIP-3 alpha/CCL20 produced in CHO cells is a polypeptide chain containing 70 amino acids. A fully biologically active molecule, rhMIP-3 alpha/CCL20 has a molecular mass of 8kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.

Usage:

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

Physical Appearance:

Sterile Filtered White lyophilized (freeze-dried) powder.

Reconstitution:

Reconstituted in ddH2O or PBS at 100 μg/ml.

Storage:

Lyophilized recombinant Human MIP-3 alpha/CCL20 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human MIP-3 alpha/CCL20 should be stable up to 1 week at 4°C or up to 2 months at -20°C.