Source:

CHO

Molecular Weight:

25-45 kDa, observed by non-reducing SDS-PAGE.

Purity:

> 95% as analyzed by SDS-PAGE.

Biological activity:

ED50 < 15 ng/ml, measured in a cell proliferation assay using TF-1 cells, corresponding to a specific activity of > 6.7×10ˆ5 units/mg.

AA Sequence:

SPGPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQ FSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN

Endotoxin:

< 0.2 EU/μg, determined by LAL method.

Formulation:

Lyophilized after extensive dialysis against PBS.

Background:

Interleukin 13 (IL-13) is an immunoregulatory cytokine produced primarily by activated Th2 cells, and also by mast cells and NK cells. Targeted deletion of IL-13 in mice resulted in impaired Th2 cell development and indicated an important role for IL-13 in the expulsion of gastrointestinal parasites. IL-13 exerts anti-inflammatory effects on monocytes and macrophages and it inhibits the expression of inflammatory cytokines such as IL-1beta, TNF-alpha, IL-6 and IL-8. IL-13 has also been shown to enhance B cell proliferation and to induce isotype switching resulting in increased production of IgE. Blocking of IL-13 activity inhibits the pathophysiology of asthma. Human and mouse IL-13 is cross-species reactive.Recombinant human interleukin 13 expressed in CHO cells is glycosylated protein with molecular weight range from 25 to 45 kDa shown in non-reducing SDS-PAGE.

Usage:

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

Physical Appearance:

Sterile Filtered White lyophilized (freeze-dried) powder.

Reconstitution:

Reconstituted in ddH2O or PBS at 100 μg/ml.

Storage:

Lyophilized recombinant human Interleukin 13 (IL-13) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rhIL-13 should be stable up to 1 week at 4°C or up to 2 months at -20°C.