Bioworld Technology

Bioworld Technology is manufacturer of over 15,000 highly purified Monoclonal and Polyclonal Antibodies, Peptides, Proteins, and other related Research Products. Their products are used in all biological fields. An important focus in research taking place today is in work investigating Signal transduction pathways, Cardiac markers, Neuroscience as well as Stem cell research. Bioworld Technology is committed to providing customers with innovative research tools and to helping scientists determine the mechanisms of cell function and disease.
Bioworld Technology is one of the leading phospho-antibody manufacturers. They have produced over 500 phospho-antibodies for AKT, AMPK, GSK, STAT pathways. The peptides corresponding to each phospho-antibody have also been listed to help scientists.
All of their high quality antibodies, peptides and kits were tested in their own facility with original published pictures included. They have a commitment to customer service and offer 100% quality satisfaction. If our products do not match the results listed on the data sheet, we will help you to troubleshoot or refund for the full credit.
Bioworld Technology continues to manufacture product lines to the highest standards; and all of their scientists are dedicated to the mystery of the world of science.

RecombinantHCC‑4/CCL16,Human(CHO-expressed) BK0219

The add to cart button will appear once you select the values above

Specifications

size	10μg / 50μg / 1mg

Source:

CHO

Molecular Weight:

12 kDa, observed by reducing SDS-PAGE.

Purity:

> 98% as analyzed by SDS-PAGE.

Biological activity:

The EC50 value of human HCC‑4/CCL16 on Caˆ2+ mobilization assay in CHO-K1/Ga15/hCCR1 cells (human Ga15 and human CCR1 stably expressed in CHO-K1 cells) is less than 1.5 μg/ml.

AA Sequence:

QPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKALNCHLPAIIFVTKRNREVCTNPNDDWVQEYIKDPNLPLLPTRNLST VKIITAKNGQPQLLNSQ

Endotoxin:

< 0.2 EU/μg, determined by LAL method.

Formulation:

Lyophilized after extensive dialysis against PBS.

Background:

Human HCC4, also named NCC4and Chemokine (C-C motif) ligand 16 (CCL16) is a small cytokine belonging to the CC chemokine family that is known under several pseudonyms, including Liver-expressed chemokine (LEC) and Monotactin-1 (MTN-1). It can signal through the CCR8 and CCR1 receptors, and it is chemotactic towards monocytes and lymphocytes but not neutrophils. HCC-4 is expressed weakly by some lymphocytes, including NK cells, T cells, and some T cell clones. The expression of HCC-4 in monocytes is greatly up-regulated in the presence of IL-10. HCC-4 induces a calcium flux in thp-1 cells that are desensitized prior to the expression of RANTES. Recombinant human HCC‑4/CCL16 produced in CHO cells is a single non-glycosylated polypeptide chain containing 97 amino acids. A fully biologically active molecule, rhHCC‑4/CCL16has a molecular mass of 12 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.

Usage:

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

Physical Appearance:

Sterile Filtered White lyophilized (freeze-dried) powder.

Reconstitution:

Reconstituted in ddH2O or PBS at 100 μg/ml.

Storage:

Lyophilized recombinant human HCC‑4/CCL16 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, human HCC‑4/CCL16 should be stable up to 1 week at 4°C or up to 2 months at -20°C.